Star 历史趋势
数据来源: GitHub API · 生成自 Stargazers.cn
README.md

FIRERPA Android | AI-Powered Automation

FIRERPA

An all-in-one Android automation framework that combines on-device services, AI-ready agents, and extensible tool invocation.

Documentation | 使用文档 | TELEGRAM | QQ Group | SKILLS | llms-full.txt | 中文版本

FIRERPA is an all-in-one Android device control platform. The server runs directly on the device with no extra runtime dependencies; it supports multiple generations of Android and works with or without root. On the PC side, the Python client library orchestrates UI automation, remote operations, traffic capture, Hook-based reverse engineering, network proxying, distributed networking, AI agents, and MCP through a single service and API. Compared with stitching together Appium, mitmproxy, frida-server, adb, uiautomator2, and ad-hoc scripts and ops tools, FIRERPA offers one source of capabilities, unified configuration, connected workflows, and a stack built for multi-device, long-running, production use.

Remote Desktop & Live Streaming

FIRERPA provides a browser-based remote desktop: view and control the device in real time without installing a dedicated PC client, over LAN or across networks. Streaming supports both MJPEG and H.264, with software and hardware encoding backends. Frame rate (up to 60fps), resolution scale, bitrate, and quality can be tuned to device capability and network conditions—reducing bandwidth and improving smoothness on weak links. WebRTC is also supported, with configurable STUN/TURN servers for better NAT traversal and lower end-to-end latency in public or cross-region setups.

The remote desktop supports multi-user concurrent access for collaborative debugging, demos, and training. Bidirectional clipboard sharing and live audio (Android 10+) are included, along with an integrated terminal, drag-and-drop uploads, and browser-based file browsing and downloads—all over a single port. Built-in visual layout inspection highlights elements, supports Tab traversal, shows coordinates and RGB values, and exports the XML layout tree so you can validate selectors and automation logic in the same UI, shortening the loop from screen to script.

demo

Remote desktop and RPC support end-to-end TLS and service-certificate access control, with optional custom WebUI login passwords to reduce exposure on public networks. Remote desktop capabilities can also be embedded into your own web apps over WebSocket (live video, touch, terminal, keys, etc.), with allow_origin for cross-origin integration—suitable for productizing real-device control.

UI Automation

FIRERPA provides a full selector-based automation system: text, resourceId, description, scrollable, and other common matchers, plus child / sibling chaining for duplicate elements, deep hierarchies, or controls without distinctive attributes. At the element level: screenshots, wait for appear/disappear, corner/center coordinates, exists checks, Unicode input, stepped swipes, fling scrolling, scroll-to-end, and more. It can coexist with other accessibility services on Android 8.0+ and improves WebView node discovery for hybrid apps.

The UI Watcher listens for UI changes in real time and runs clicks, key events, or counters when conditions match—useful for auto-dismissing agreements, update prompts, ads, and other interruptions. Multiple selector conditions and per-event enable/disable are supported; transient screens can be counted.

Virtual Display is a differentiator: create isolated background displays on the device and run apps and automation there without affecting the main screen—e.g. auto-reply on a virtual display while you use the phone normally. The virtual-display API mirrors the main device API (d.xxxvd.xxx); Watchers can be scoped to a virtual display. The WebUI supports multi-display view and switching in remote desktop—ideal for background tasks, parallel work, and human-in-the-loop plus machine automation.

For scenes without a standard view tree (games, custom-drawn UI), FIRERPA offers OCR and image matching. OCR supports paddleocr, easyocr, and custom HTTP backends; in clusters, recognition can run centrally instead of loading models on every PC, with GPU acceleration and flexible text matching. Image matching runs on the device (template or SIFT), without consuming PC resources; SIFT is robust to rotation, scale, and lighting. Multi-touch supports recording, replay, programmatic construction, and binary persistence for complex gestures and pressure.

Architecturally, FIRERPA uses a client/server model—better for centralized scheduling, versioning, and fleet control than on-device script runners like AutoJS; lighter than Appium; more stable than uiautomator2 in multi-device scenarios. The docs position it as a functional superset of common Android automation stacks—automation, capture, Hook, and ops can be chained in code on one platform without switching tools.

Packet Capture & MITM

FIRERPA offers one-click MITM capture: automatic system root CA install, proxy setup, handling of Android version differences, and automatic network restore on exit—no manual cert or proxy toggling. Global capture, per-package capture, live request/response editing, shared mitmweb, and upstream HTTP proxy for international traffic are supported. Built-in QUIC downgrade reduces QUIC interference. Capture still works when PC and device only share a single FIRERPA port (e.g. ADB connect or frp forwarding).

Beyond one-click scripts, MITM is fully API-driven: install/uninstall system CAs compatible with mitmproxy, Fiddler, Charles, etc.; embed capture in automation pipelines alongside UI steps and Frida hooks. A Windows startmitm.exe is available without a Python install.

Network, Proxy & Connectivity

On the device, FIRERPA provides full proxy support: HTTP / HTTPS / SOCKS5 / Shadowsocks (multiple ciphers), per-app proxy (including multi-user clones), DNS proxy, UDP proxy, LAN bypass, coexistence with OpenVPN, and auto-connect to configured proxies at startup. Proxies support IPv6 and UDP for complex networks.

Device HTTP bridge proxy (tunnel2) provides reverse-proxy capability: point your PC or browser HTTP proxy at the phone and traffic is forwarded through the phone’s network egress; the outbound IP matches the phone. Wi‑Fi or cellular (rmnet) can be chosen as the egress interface—useful for joint debugging, international apps, and multi-device IP pools.

A built-in OpenVPN client supports certificate, username/password, and mixed auth, alongside system proxy; an OpenVPN Docker image and config generators produce device-side code and autostart settings. A built-in frp client forwards device services to a public server via fwd.*, with encryption and TLS.

mDNS discovery enables {device_id}.local access to remote desktop and other services, with optional TXT metadata (model, ABI, device ID) for LAN fleet discovery.

Frida & Reverse Engineering

FIRERPA bundles the latest Frida—no separate frida-server. Use frida tooling from the remote desktop terminal without -U, -H, etc. Built-in hiding patches (open-source plus in-house) are maintained against detection; connections use token auth over the FIRERPA port. objection patches and Frida 17.x java-bridge helpers ease migration.

Persistent Frida scripts re-inject after app crash or exit; YAML offline persistence with directory watch and hot reload. Frida RPC maps to Python methods and HTTP + JSON-RPC 2.0 remote calls on JVM, UI main, or pure JS threads. Script emit data can go to HTTP / Redis / RabbitMQ (MQTT) with device/app metadata, zlib compression, HTTP retries, and MQTT TLS.

ADB, SSH & Built-in Terminal

FIRERPA includes a standalone built-in ADB—wireless high-privilege ADB without enabling system Developer Options, useful when apps detect developer mode. Magisk modules can preinstall adb_keys for default authorization. Built-in SSH plus ssh.sh / scp.sh for remote shell and file transfer.

The built-in terminal ships with strace, ltrace, tcpdump, scapy, fsmon, frida-tools, MemDumper, and Python stacks such as Crypto, cv2, unicorn, capstone, keystone, redis, and grpc. sqlite3 supports wxsqlite / sqlcipher / sqlcrypto for reading encrypted databases from apps such as WeChat, WeCom, and Alibaba-family clients. One environment across remote desktop, SSH, and ADB—analyze and control on-device with less PC shuttling.

Distributed & Multi-Device Management

FIRERPA StarLink Platform (Hub + hub-bridge) provides centralized multi-device access for local and remote devices with unified management and P2P access—ideal for “device at home, operator elsewhere” and multi-device collaboration. hub v3 uses SAPI for unified requests to local and remote devices. Besides Hub, frp forwarding and OpenVPN mesh are also supported as self-hosted options, with full documentation and Docker support.

Since 9.0, P2P Bridge peer connectivity and a built-in distributed task system are supported; since 7.50, a networking subscription service is available so you need not self-host frp/OpenVPN. Designed for cloud phone pools, device farms, and emulator clusters—batch devices, always-on, unattended operation.

AI / MCP / Agent

FIRERPA includes an MCP server (/mcp/) on streamable-http, with tool calls, resource reads, prompts, progress notifications, and logs—compatible with Claude, Cursor, and other MCP clients. Official MCP extensions live under ~/modules/extension.

The built-in agent command drives the device in natural language via any OpenAI-compatible API with tool calls, including vision mode, plus an OpenAI semantic task executor. Combine with crontab for scheduled AI tasks on real devices.

MCP

System Control & Extensions

160+ Python APIs cover app ops, file I/O, command execution, device status, WiFi, proxy, OpenVPN, shutdown/reboot, service logs, and more. setprop can write ro.* read-only properties; Settings APIs adjust brightness, developer mode, etc.; SELinux domain creation, permissive mode, and fine-grained allow/disallow. Full multi-instance app APIs, silent grant/revoke permissions, launching non-exported activities, disabling apps to save resources.

Binary patching (hex wildcards, glob paths, dryrun) and runtime metrics for disk, battery, CPU, memory, and network I/O. WAV playback and internal storage APIs. On-device tflite-runtime with hardware-accelerated compute for edge inference.

A virtual Debian environment runs full Debian with apt—compile BPF, deploy OpenSSH, install arbitrary Python deps beyond the built-in terminal’s limits.

Deployment, Security & Governance

Deploy via one-click APP (root or Shizuku), Magisk module autostart, manual extract, or ROM integration—designed for 24/7 operation. The APP can auto-generate service certificates; Magisk zips can ship properties, lamda.pem, and adb_keys. INI service configuration centralizes port, WebUI, certificates, OpenVPN, gproxy, frp, tunnel2, cron, sshd, adb, mdns, etc.; WebUI offers visual editing, raw text, and Reload Service, plus remote config file loading.

Root and shell identities; arm64, armeabi-v7a, x86, x86_64; real devices, emulators (LDPlayer, Nox, etc.), Redroid, WSA, AVD, cloud phones. Clean uninstall paths. API exclusive lock prevents client contention. Privacy policy: no collection of contacts, SMS, location, etc.; offline licensing supported.

Tooling & Evolution

Six-plus years of continuous development, with Android 14–16 compatibility fixes and ongoing work on multi-user remote desktop, standardized touch APIs, MCP, Frida versions and stealth, proxy IPv6/UDP, P2P Bridge, and distributed tasks.

FIRERPA’s strength is not any single feature but integrating remote desktop (WebRTC/H.264/multi-user), UI automation (virtual display, Watcher, OCR, image match, multi-touch), one-click capture, built-in Frida, full-stack proxy and VPN/frp/P2P, ADB/SSH/built-in terminal, AI MCP/Agent, system-level control, virtual Debian, persistent KV, and script encryption on one Android device, one service, and one Python client—so security testing, compliance analysis, protocol recovery, fleet management, and automation run in one pipeline instead of many glued tools.

关于 About

Android Full-Stack Device Control Platform: WebRTC/H.264 remote desktop, UI/OCR/image-matching automation, one-click MITM, built-in Frida, proxy/VPN/frp/P2P networking, MCP/Agent, 160+ APIs, designed for multi-device clusters and engineered deployments.
adbagentsaiai-agentsandroidappiumautomationdynamic-analysisfridamagiskmcpmcp-servermobile-securityremote-controlreverse-engineeringsecurityuiautomationuiautomator2xposed

语言 Languages

Python63.1%
C28.0%
Shell7.2%
Dockerfile1.0%
JavaScript0.7%

提交活跃度 Commit Activity

代码提交热力图
过去 52 周的开发活跃度
20
Total Commits
峰值: 2次/周
Less
More

核心贡献者 Contributors