Star 历史趋势
数据来源: GitHub API · 生成自 Stargazers.cn
README.md

Work Review

Work Review

A local-first personal work review tool that records context, helps you review your day, and generates daily reports.

Automatically organizes the apps you used, websites you visited, window titles, usage time, and optional screenshots into a timeline you can review, analyze, and ask questions about.

All data is stored locally by default and never uploaded to any server. AI features are entirely optional; the app works fine with them turned off.

🔒 For personal use only — all data stays on your device.

English · 简体中文 · 繁體中文

Release Platform All Data Local License


What It Solves

Work Review is designed for personal work review and helps answer questions like these:

  • What did I actually do today?
  • What have I been focusing on over the past few days?
  • Roughly how much time did a particular task take?
  • Which pages, windows, and context did I look at back then?
  • How can I quickly put together today's daily report?

The focus is not "monitoring". It is helping you recall, organize, and review your own work process.


Core Capabilities

  • Automatic work context recording — Records foreground apps, browser pages, window titles, usage time, optional screenshots, and OCR text, reducing manual note-taking
  • Unified timeline and statistics — Overview, timeline, work assistant, and daily report share the same local records, so you can inspect trends and drill into context
  • Questions over local records — Use the basic template or your configured model to answer "What did I do today?", "How long did this task take?", and "What have I been focused on?"
  • Daily report generation and export — Generate structured daily reports with Markdown export, auto-export, paragraph editing, pin/hide controls, and cached AI section ordering
  • Privacy-first and locally controllable — Data is stored in local SQLite by default; AI is optional, and model calls use your own API key without third-party relay
  • Desktop Avatar Beta — Shows work status through a desktop avatar and is gradually expanding toward proactive reminders and context assistance

Interface Preview

The screenshots below are captured from the running desktop app with localized UI and representative local data, covering the main workflow and configuration surfaces.

Core Workflow

Core workflow animation

Overview

Overview

Timeline

Timeline

Timeline Detail

Timeline Detail

Daily Report

Daily Report

Work Assistant

Work Assistant

Integrations

Integrations and MCP Server settings

More screenshots: summaries, settings, and about page

Hourly Summary

Hourly Summary

General Settings

General Settings

Appearance

Appearance Settings

AI Models

AI Model Settings

Desktop Avatar

Desktop Avatar Settings

Privacy

Privacy Settings

Storage

Storage Settings

About

About Work Review


Privacy and Boundaries

Work Review is designed for personal use from the ground up. It is not intended for: employee monitoring · team attendance · performance evaluation · covert tracking

You can control the recording scope as needed:

  • Per-app settings: Normal / Anonymize / Ignore — anonymize mode automatically skips screenshots and OCR
  • Automatic sensitive keyword filtering · domain blacklist
  • Auto-pause on screen lock · manual pause/resume
  • AI only activates after you configure a model; disabled by default

Feature Overview

Automatic Recording

  • Foreground apps, window titles, browser URLs, usage duration, and category records
  • Optional screenshots and OCR with multi-display strategies
  • Keyboard/mouse activity + screen-change idle detection to reduce false records
  • Timeline review for pages, windows, and context from any time period

Smart Organization

  • Work assistant based on local records, with basic template, AI-enhanced modes, and dynamic opening prompts after a model is configured
  • Duration statistics, category filtering, trend comparison, natural-language time ranges, and hourly activity across Today, Week, Date, and Range views
  • Fragments grouped into continuous work sessions
  • Extracts potential follow-up to-dos from pages, window titles, and context

Daily Reports and Review

  • Structured daily reports, historical review, Markdown export, and auto-export
  • Report blocks for hourly activity, time distribution, app usage, website visits, and more
  • Paragraph-level pin/hide/restore controls, with cached AI section ordering
  • AI-enhanced prompt attachments and custom model settings
  • Website semantic categorization: changing a domain category automatically backfills history
  • Multi-segment work time: e.g. morning + afternoon, break time excluded

AI Modes

The core of Work Review is always local recording. AI's role is to make records easier to read and review, not a prerequisite for usage.

ModeDescription
Basic TemplateZero configuration, outputs stable structured results
AI EnhancedCalls your self-configured model service for more natural Q&A and summaries

Supported providers: Ollama (local) / OpenAI compatible / DeepSeek / Qwen / Zhipu / Kimi / Doubao / MiniMax / SiliconFlow / Gemini / Claude


Quick Start

  1. Download the installer for your platform from Releases
  2. On macOS, grant Screen Recording and Accessibility permissions
  3. Let it run in the background for a while
  4. Check the Overview / Timeline / Daily Report to see your recorded activity
PlatformInstaller
macOS (Apple Silicon / Intel).dmg
Windows.exe / portable .zip
Linux x86_64 (X11 / Wayland).deb / .AppImage
Linux ARM64 (aarch64).deb

macOS: Screenshots require the "Screen Recording" permission, and avatar linkage requires "Accessibility + Input Monitoring". If you see a "damaged" warning on first launch: sudo xattr -rd com.apple.quarantine "/Applications/Work Review.app"

Windows: Depends on Microsoft Edge WebView2 Runtime.

Linux: Screenshots and window tracking depend on the current session type and toolchain.

Dependency details

# Base
sudo apt install xprintidle tesseract-ocr
# X11
sudo apt install xdotool x11-utils scrot
# Wayland: gdbus (GNOME) / kdotool (KDE) / swaymsg (Sway) / hyprctl (Hyprland)
# Screenshots: grim / gnome-screenshot / spectacle

Ubuntu 24.04 / 24.10 Wayland (GNOME 46–47) users experiencing screenshot flash or shutter sound can use the one-click install script to fix it automatically:

bash scripts/deb/reinstall.sh           # deb method (recommended)
bash scripts/deb/reinstall.sh --dry-run # preview operations

See scripts/ubuntu-wayland-README.md for details.

KDE Plasma / Wayland startup crash (Fedora, Arch, openSUSE, …): If the app quits immediately with Gdk-Message: Error 71 (Protocol error) dispatching to Wayland display., it is an upstream webkit2gtk/GTK bug on Wayland (see tauri#10702), most common on KDE Plasma + NVIDIA. Recent builds already inject WEBKIT_DISABLE_DMABUF_RENDERER=1 at startup. If you still hit it on an older build, launch it with the same workaround manually:

WEBKIT_DISABLE_DMABUF_RENDERER=1 ./Work_Review

If that still fails, force the X11 backend as a last-resort fallback. This may render worse on some Wayland desktops:

GDK_BACKEND=x11 ./Work_Review

Extended Capabilities (Beta)

Desktop Avatar

Uses a standalone desktop pet window to reflect idle / working / reading / meeting / music / video states.

Desktop Avatar

Still being actively refined — interaction linkage, state expression, and preset details will continue to improve.

Bot Integration (Telegram / Feishu)

Query records and generate daily reports remotely from Telegram / Feishu via local API + multi-device registration. Supported commands: /devices, /report, /generate, etc. Restricted to personal and own multi-device use only.

Localhost API

After Localhost API is enabled, the app exposes a local HTTP API (default 127.0.0.1:47831), authenticated with a Bearer Token (auto-generated on first launch, saved in localhost_api_token.txt in the data directory).

Authentication

All requests (except /health and Feishu callbacks) must carry the token:

Authorization: Bearer <token>

Or via query parameter: ?token=<token>

Endpoints

MethodPathDescription
GET/healthHealth check (no auth)
GET/v1/deviceDevice info
GET/v1/timeline/{date}Timeline (date format YYYY-MM-DD, supports ?limit=&offset=)
GET/v1/activities/{date}Activity list (supports ?limit=&offset=&category=)
GET/v1/stats/todayToday's stats
GET/v1/stats/overviewOverview stats (`?mode=today
GET/v1/stats/daily/{date}Stats for a given date
GET/v1/reportsReport list (?limit=)
GET/v1/reports/{date}Report for a given date (?locale=)
GET/v1/reports/generateGenerate report (?date=&locale=&force=true)
POST/v1/reports/export-markdownExport report as Markdown (body: { date, locale })
GET/v1/apps/recentRecently used apps
GET/v1/apps/category-overviewApp category overview
GET/v1/categoriesApp category list
GET/v1/categories/semanticSemantic category list
GET/v1/hourly-summaries/{date}Hourly summary
GET/v1/hourly-app-breakdown/{date}Hourly app breakdown
GET/v1/weekly-reviewWeekly review (?date_from=&date_to=&limit=)
GET/v1/storage/statsStorage stats

Examples

# Get today's timeline
curl -H "Authorization: Bearer $(cat ~/work-review/localhost_api_token.txt)" \
  http://127.0.0.1:47831/v1/timeline/2026-05-20

# Generate a report
curl -H "Authorization: Bearer $(cat ~/work-review/localhost_api_token.txt)" \
  "http://127.0.0.1:47831/v1/reports/generate?date=2026-05-20"
MCP Server

Connects work records to AI coding tools (Claude Code / Cursor / VS Code Copilot, etc.) via the stdio protocol.

cargo build --release -p work-review-mcp-server
{
  "mcpServers": {
    "work-review": {
      "command": "/path/to/work-review-mcp-server",
      "env": {
        "WORK_REVIEW_DB_PATH": "/path/to/work_review.db",
        "WORK_REVIEW_CONFIG_PATH": "/path/to/config.json"
      }
    }
  }
}

Development

npm install
npm run tauri:dev    # Development
npm run tauri:build  # Build

Requires: Node.js 18+ / Rust stable / Tauri 2 CLI · Tech stack: Tauri 2 + Rust + Svelte 4 + SQLite


Community

WeChat Group

WeChat Group

If the QR code has expired, follow the official account below for the latest group invitation, or join the TG group


WeChat Official Account

Official Account


Telegram

Acknowledgements

License

MIT © 2026 wm94i


Star History

Star History

关于 About

Automatically tracks which apps you used, which websites you visited, and how much time you spent in each app throughout the day.
aidaily-reportdashboardprivacyproductivitytime-trackingtimetrackertimetrackingwork-log

语言 Languages

Rust57.5%
Svelte20.6%
JavaScript16.8%
CSS2.2%
Python1.6%
Shell1.2%
HTML0.0%

提交活跃度 Commit Activity

代码提交热力图
过去 52 周的开发活跃度
307
Total Commits
峰值: 45次/周
Less
More

核心贡献者 Contributors